GON7 Antibody - C-terminal region (ARP69018_P050)

• Product Number: ARP69018_P050
• Name: GON7 Antibody - C-terminal region (ARP69018_P050)
• Protein Size (# AA): 100 amino acids
• Molecular Weight: 11kDa
• NCBI Gene Id: 84520
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: GON7, KEOPS complex subunit
• Alias Symbols: PNAS-127, C14orf142
• Peptide Sequence: Synthetic peptide located within the following region: LVQGEVQHRVAAAPDEDLDGDDEDDAEDENNIDNRTNFDGPSAKRPKTPS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Interactions: UBC; P3H1; PPME1; TPRKB; DBNL; HSPBP1; GPN1; ARPC1A; ARPC1B; OGT; HSF1; CBS; ALAD; TP53RK; OSGEP; LAGE3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GON7 (ARP69018_P050) antibody is Catalog # AAP69018
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human C14orf142
• Uniprot ID: Q9BXV9
• Protein Name: EKC/KEOPS complex subunit GON7
• Publications:

  Proteomic analysis of the human KEOPS complex identifies C14ORF142 as a core subunit homologous to yeast Gon7. Nucleic Acids Res. 45, 805-817 (2017). 27903914

• Protein Accession #: NP_115879
• Purification: Affinity Purified
• Nucleotide Accession #: NM_032490
• Tested Species Reactivity: Human
• Gene Symbol: GON7
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 91%; Pig: 79%; Rat: 91%
• Image 1: Human Jurkat
  
  Host: Rabbit
  Target Name: C14orf142
  Sample Type: Jurkat Whole Cell lysates
  Antibody Dilution: 2.0ug/ml