APOPT1 Antibody - C-terminal region (ARP69014_P050)

Data Sheet
 
Product Number ARP69014_P050
Product Page www.avivasysbio.com/apopt1-antibody-c-terminal-region-arp69014-p050.html
Name APOPT1 Antibody - C-terminal region (ARP69014_P050)
Protein Size (# AA) 206 amino acids
Molecular Weight 20kDa
NCBI Gene Id 84334
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols APOP, APOP1, APOPT1, MC4DN17, C14orf153
Peptide Sequence Synthetic peptide located within the following region: KEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKRSN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target APOPT1 plays a role in the regulation of apoptosis. It mediates mitochondria-induced cell death in vascular smooth muscle cells through the release of cytochrome c from mitochondria, followed by the activation of the caspase cascade.
Protein Interactions BAG3; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-APOPT1 (ARP69014_P050) antibody
Blocking Peptide For anti-APOPT1 (ARP69014_P050) antibody is Catalog # AAP69014
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human APOPT1
Uniprot ID Q96IL0
Protein Name Apoptogenic protein 1, mitochondrial
Protein Accession # NP_115750
Purification Affinity Purified
Nucleotide Accession # NM_032374
Tested Species Reactivity Human
Gene Symbol APOPT1
Predicted Species Reactivity Human, Cow, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 82%; Horse: 82%; Human: 100%
Image 1
Human Jurkat
Host: Rabbit
Target Name: APOPT1
Sample Type: Jurkat Whole Cell lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com