Product Number |
ARP69014_P050 |
Product Page |
www.avivasysbio.com/apopt1-antibody-c-terminal-region-arp69014-p050.html |
Name |
APOPT1 Antibody - C-terminal region (ARP69014_P050) |
Protein Size (# AA) |
206 amino acids |
Molecular Weight |
20kDa |
NCBI Gene Id |
84334 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
APOP, APOP1, APOPT1, MC4DN17, C14orf153 |
Peptide Sequence |
Synthetic peptide located within the following region: KEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKRSN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
APOPT1 plays a role in the regulation of apoptosis. It mediates mitochondria-induced cell death in vascular smooth muscle cells through the release of cytochrome c from mitochondria, followed by the activation of the caspase cascade. |
Protein Interactions |
BAG3; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-APOPT1 (ARP69014_P050) antibody |
Blocking Peptide |
For anti-APOPT1 (ARP69014_P050) antibody is Catalog # AAP69014 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human APOPT1 |
Uniprot ID |
Q96IL0 |
Protein Name |
Apoptogenic protein 1, mitochondrial |
Protein Accession # |
NP_115750 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_032374 |
Tested Species Reactivity |
Human |
Gene Symbol |
APOPT1 |
Predicted Species Reactivity |
Human, Cow, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 82%; Horse: 82%; Human: 100% |
Image 1 | Human Jurkat
| Host: Rabbit Target Name: APOPT1 Sample Type: Jurkat Whole Cell lysates Antibody Dilution: 1.0ug/ml |
|
|