| Product Number |
ARP68745_P050 |
| Product Page |
www.avivasysbio.com/c1orf112-antibody-c-terminal-region-arp68745-p050.html |
| Name |
C1orf112 Antibody - C-terminal region (ARP68745_P050) |
| Protein Size (# AA) |
718 amino acids |
| Molecular Weight |
78kDa |
| NCBI Gene Id |
55732 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
RP1-97P20.1 |
| Peptide Sequence |
Synthetic peptide located within the following region: TEAAKVERVKQEKGIFWEPFANVTVEEAKRSSLQPYAKRARQEFPWEEEY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
APP; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-C1orf112 (ARP68745_P050) antibody |
| Blocking Peptide |
For anti-C1orf112 (ARP68745_P050) antibody is Catalog # AAP68745 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human C1orf112 |
| Uniprot ID |
Q9NSG2-2 |
| Protein Name |
Uncharacterized protein C1orf112 |
| Protein Accession # |
NP_060656 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_018186 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
C1orf112 |
| Predicted Species Reactivity |
Human, Cow, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 77%; Dog: 85%; Horse: 85%; Human: 100%; Pig: 86% |
| Image 1 | Human THP-1
 | Host: Rabbit
Target Name: C1orf112
Sample Type: THP-1 Whole Cell lysates
Antibody Dilution: 1.0ug/ml |
|
|
