DDX60L Antibody - N-terminal region (ARP68258_P050)

Data Sheet
 
Product Number ARP68258_P050
Product Page www.avivasysbio.com/ddx60l-antibody-n-terminal-region-arp68258-p050.html
Name DDX60L Antibody - N-terminal region (ARP68258_P050)
Protein Size (# AA) 1706 amino acids
Molecular Weight 187kDa
NCBI Gene Id 91351
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols -
Peptide Sequence Synthetic peptide located within the following region: YAYTMESTDRNQTFSKENETVIQSAYKSLIQHLEEIRVLVLATHFEHLKW
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DDX60L (ARP68258_P050) antibody
Blocking Peptide For anti-DDX60L (ARP68258_P050) antibody is Catalog # AAP68258
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human DDX60L
Uniprot ID Q5H9U9
Protein Name Probable ATP-dependent RNA helicase DDX60-like
Publications

DDX60L Is an Interferon-Stimulated Gene Product Restricting Hepatitis C Virus Replication in Cell Culture. J. Virol. 89, 10548-68 (2015). 26269178

Protein Accession # NP_001012985
Purification Affinity Purified
Nucleotide Accession # NM_001012967
Tested Species Reactivity Human
Gene Symbol DDX60L
Predicted Species Reactivity Human, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Horse: 77%; Human: 100%
Image 1
Human PANC1
Host: Rabbit
Target Name: DDX60L
Sample Type: PANC1 Whole Cell lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com