Product Number |
ARP68258_P050 |
Product Page |
www.avivasysbio.com/ddx60l-antibody-n-terminal-region-arp68258-p050.html |
Name |
DDX60L Antibody - N-terminal region (ARP68258_P050) |
Protein Size (# AA) |
1706 amino acids |
Molecular Weight |
187kDa |
NCBI Gene Id |
91351 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
- |
Peptide Sequence |
Synthetic peptide located within the following region: YAYTMESTDRNQTFSKENETVIQSAYKSLIQHLEEIRVLVLATHFEHLKW |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DDX60L (ARP68258_P050) antibody |
Blocking Peptide |
For anti-DDX60L (ARP68258_P050) antibody is Catalog # AAP68258 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human DDX60L |
Uniprot ID |
Q5H9U9 |
Protein Name |
Probable ATP-dependent RNA helicase DDX60-like |
Publications |
DDX60L Is an Interferon-Stimulated Gene Product Restricting Hepatitis C Virus Replication in Cell Culture. J. Virol. 89, 10548-68 (2015). 26269178 |
Protein Accession # |
NP_001012985 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001012967 |
Tested Species Reactivity |
Human |
Gene Symbol |
DDX60L |
Predicted Species Reactivity |
Human, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Horse: 77%; Human: 100% |
Image 1 | Human PANC1
| Host: Rabbit Target Name: DDX60L Sample Type: PANC1 Whole Cell lysates Antibody Dilution: 1.0ug/ml |
|
|