| Product Number |
ARP68235_P050 |
| Product Page |
www.avivasysbio.com/ints11-antibody-c-terminal-region-arp68235-p050.html |
| Name |
INTS11 Antibody - C-terminal region (ARP68235_P050) |
| Protein Size (# AA) |
278 amino acids |
| Molecular Weight |
30kDa |
| NCBI Gene Id |
54973 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
integrator complex subunit 11 |
| Alias Symbols |
RC68, INT11, RC-68, CPSF3L, CPSF73L |
| Peptide Sequence |
Synthetic peptide located within the following region: TESTYATTIRDSKRCRERDFLKKVHETVERGGKGAHEPEGAHLLLHGADR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The Integrator complex contains at least 12 subunits and associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates the 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 180690). INTS11, or CPSF3L, is the catalytic subunit of the Integrator complex (Baillat et al., 2005 [PubMed 16239144]).[supplied by OMIM, Mar 2008] |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-INTS11 (ARP68235_P050) antibody |
| Blocking Peptide |
For anti-INTS11 (ARP68235_P050) antibody is Catalog # AAP68235 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human CPSF3L |
| Uniprot ID |
Q5TA45 |
| Protein Name |
integrator complex subunit 11 |
| Protein Accession # |
NP_001243385.1 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001256456.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
INTS11 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 77%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human 721_B
 | Host: Rabbit
Target Name: CPSF3L
Sample Type: 721_B Whole Cell lysates
Antibody Dilution: 1.0ug/ml |
|
|
