C17orf53 Antibody - middle region (ARP68135_P050)

Data Sheet
 
Product Number ARP68135_P050
Product Page www.avivasysbio.com/c17orf53-antibody-middle-region-arp68135-p050.html
Name C17orf53 Antibody - middle region (ARP68135_P050)
Protein Size (# AA) 521 amino acids
Molecular Weight 57kDa
NCBI Gene Id 78995
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols MCM8IP, C17orf53
Peptide Sequence Synthetic peptide located within the following region: QPFQSPSSWLSGKAHLPRPRTPNSSCSTPSRTSSGLFPRIPLQPQAPVSS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Protein Interactions PRMT1; HECW2; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-C17orf53 (ARP68135_P050) antibody
Blocking Peptide For anti-C17orf53 (ARP68135_P050) antibody is Catalog # AAP68135
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human C17orf53
Uniprot ID Q8N3J3-3
Protein Name Uncharacterized protein C17orf53
Purification Affinity Purified
Tested Species Reactivity Human
Gene Symbol C17orf53
Predicted Species Reactivity Human, Cow, Dog, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 86%; Horse: 92%; Human: 100%; Rabbit: 86%
Image 1
Human OVCAR-3
Host: Rabbit
Target Name: C17orf53
Sample Type: OVCAR-3 Whole Cell lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com