Product Number |
ARP68135_P050 |
Product Page |
www.avivasysbio.com/c17orf53-antibody-middle-region-arp68135-p050.html |
Name |
C17orf53 Antibody - middle region (ARP68135_P050) |
Protein Size (# AA) |
521 amino acids |
Molecular Weight |
57kDa |
NCBI Gene Id |
78995 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
MCM8IP, C17orf53 |
Peptide Sequence |
Synthetic peptide located within the following region: QPFQSPSSWLSGKAHLPRPRTPNSSCSTPSRTSSGLFPRIPLQPQAPVSS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Protein Interactions |
PRMT1; HECW2; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-C17orf53 (ARP68135_P050) antibody |
Blocking Peptide |
For anti-C17orf53 (ARP68135_P050) antibody is Catalog # AAP68135 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human C17orf53 |
Uniprot ID |
Q8N3J3-3 |
Protein Name |
Uncharacterized protein C17orf53 |
Purification |
Affinity Purified |
Tested Species Reactivity |
Human |
Gene Symbol |
C17orf53 |
Predicted Species Reactivity |
Human, Cow, Dog, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 86%; Horse: 92%; Human: 100%; Rabbit: 86% |
Image 1 | Human OVCAR-3
| Host: Rabbit Target Name: C17orf53 Sample Type: OVCAR-3 Whole Cell lysates Antibody Dilution: 1.0ug/ml |
|
|