| Product Number |
ARP68048_P050 |
| Product Page |
www.avivasysbio.com/1110021j02rik-antibody-middle-region-arp68048-p050.html |
| Name |
Ccdc167 Antibody - middle region (ARP68048_P050) |
| Protein Size (# AA) |
101 amino acids |
| Molecular Weight |
11kDa |
| NCBI Gene Id |
68597 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
coiled-coil domain containing 167 |
| Alias Symbols |
1110021J02Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: MTKKKRENLGVAQEIDGLEEKLSRCRKDLEAVTSQLYRAELSPEDRRSLE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for ARP68048_P050 |
| Blocking Peptide |
Catalog # AAP68048 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Mouse 1110021J02Rik |
| Uniprot ID |
Q9D162 |
| Protein Name |
Coiled-coil domain-containing protein 167 |
| Protein Accession # |
NP_001157213 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001163741 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Ccdc167 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 93%; Rabbit: 100%; Rat: 92% |
| Image 1 | Mouse Small Intestine
 | Host: Rabbit
Target Name: 1110021J02Rik
Sample Type: Mouse Small Intestine lysates
Antibody Dilution: 1.0ug/ml |
|
|
