| Product Number |
ARP68023_P050 |
| Product Page |
www.avivasysbio.com/c1qtnf8-antibody-c-terminal-region-arp68023-p050.html |
| Name |
C1QTNF8 Antibody - C-terminal region (ARP68023_P050) |
| Protein Size (# AA) |
252 amino acids |
| Molecular Weight |
28kDa |
| NCBI Gene Id |
390664 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
CTRP8, UNQ5829 |
| Peptide Sequence |
Synthetic peptide located within the following region: AQPSERSVMQAQSLMLLLAAGDAVWVRMFQRDRDNAIYGEHGDLYITFSG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-C1QTNF8 (ARP68023_P050) antibody |
| Blocking Peptide |
For anti-C1QTNF8 (ARP68023_P050) antibody is Catalog # AAP68023 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human C1QTNF8 |
| Uniprot ID |
P60827 |
| Protein Name |
Complement C1q tumor necrosis factor-related protein 8 |
| Protein Accession # |
NP_997302 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_207419 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
C1QTNF8 |
| Predicted Species Reactivity |
Human, Cow, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Horse: 100%; Human: 100% |
| Image 1 | Human Fetal Liver
 | Host: Rabbit
Target Name: C1QTNF8
Sample Type: Fetal Liver lysates
Antibody Dilution: 1.0ug/ml |
|
|
