| Product Number |
ARP67926_P050 |
| Product Page |
www.avivasysbio.com/abhd14a-antibody-c-terminal-region-arp67926-p050.html |
| Name |
ABHD14A Antibody - C-terminal region (ARP67926_P050) |
| Protein Size (# AA) |
271 amino acids |
| Molecular Weight |
30kDa |
| NCBI Gene Id |
25864 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
DORZ1 |
| Peptide Sequence |
Synthetic peptide located within the following region: IAPTSTQNYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHSVVK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
ABHD14A play a possible role in granule neuron development. |
| Protein Interactions |
GINS3; BZW2; RAP1GDS1; PPP5C; CTSA; PFAS; PAFAH1B2; EIF6; HSPA9; GSS; ECHS1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ABHD14A (ARP67926_P050) antibody |
| Blocking Peptide |
For anti-ABHD14A (ARP67926_P050) antibody is Catalog # AAP67926 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ABHD14A |
| Uniprot ID |
Q9BUJ0 |
| Protein Name |
Alpha/beta hydrolase domain-containing protein 14A |
| Sample Type Confirmation |
ABHD14A is supported by BioGPS gene expression data to be expressed in HEK293T |
| Protein Accession # |
NP_056222 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_015407 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ABHD14A |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rat: 86% |
| Image 1 | Human Adult Liver
 | Rabbit Anti-ABHD14A Antibody
Catalog Number: ARP67926_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Cytoplasm in hepatocytes, strong signal, wide tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
|
| Image 2 | Human 293T
 | Host: Rabbit
Target Name: ABHD14A
Sample Type: 293T Whole Cell lysates
Antibody Dilution: 1.0ug/mlABHD14A is supported by BioGPS gene expression data to be expressed in HEK293T |
|
