YARS2 Antibody - C-terminal region (ARP67912_P050)

• Product Number: ARP67912_P050
• Name: YARS2 Antibody - C-terminal region (ARP67912_P050)
• Protein Size (# AA): 477 amino acids
• Molecular Weight: 52kDa
• NCBI Gene Id: 51067
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: TYRRS, CGI-04, MLASA2, MT-TYRRS
• Peptide Sequence: Synthetic peptide located within the following region: QPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a mitochondrial protein that catalyzes the attachment of tyrosine to tRNA(Tyr). Mutations in this gene are associated with myopathy with lactic acidosis and sideroblastic anemia type 2 (MLASA2).
• Protein Interactions: FAM9B; UBC; BMI1; DDRGK1; CAND1; CUL3; Ybx1; ICT1; USP49; CDC20;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-YARS2 (ARP67912_P050) antibody is Catalog # AAP67912
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human YARS2
• Uniprot ID: Q9Y2Z4
• Protein Name: Tyrosine--tRNA ligase, mitochondrial
• Protein Accession #: NP_001035526
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001040436
• Tested Species Reactivity: Human
• Gene Symbol: YARS2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 85%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 79%; Rat: 86%
• Image 1: Human MCF7
  
  Host: Rabbit
  Target Name: YARS2
  Sample Type: MCF7 Whole Cell lysates
  Antibody Dilution: 1.0ug/ml