| Product Number |
ARP67906_P050 |
| Product Page |
www.avivasysbio.com/vwc2-antibody-n-terminal-region-arp67906-p050.html |
| Name |
VWC2 Antibody - N-terminal region (ARP67906_P050) |
| Protein Size (# AA) |
325 amino acids |
| Molecular Weight |
36kDa |
| NCBI Gene Id |
375567 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
UNQ739, PSST739 |
| Peptide Sequence |
Synthetic peptide located within the following region: LEKLAQAPEQPGQEKREHASRDGPGRVNELGRPARDEGGSGRDWKSKSGR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a secreted bone morphogenic protein antagonist. The encoded protein is possibly involved in neural function and development and may have a role in cell adhesion. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-VWC2 (ARP67906_P050) antibody |
| Blocking Peptide |
For anti-VWC2 (ARP67906_P050) antibody is Catalog # AAP67906 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human VWC2 |
| Uniprot ID |
Q2TAL6 |
| Protein Name |
Brorin |
| Protein Accession # |
NP_940972 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_198570 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
VWC2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Human Fetal Liver
 | Host: Rabbit
Target Name: VWC2
Sample Type: Fetal Liver lysates
Antibody Dilution: 1.0ug/ml |
|
|
