Psmg2 Antibody - middle region (ARP67762_P050)

• Product Number: ARP67762_P050
• Name: Psmg2 Antibody - middle region (ARP67762_P050)
• Protein Size (# AA): 264 amino acids
• Molecular Weight: 29kDa
• NCBI Gene Id: 107047
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: proteasome (prosome, macropain) assembly chaperone 2
• Alias Symbols: Cla, Tnfsf, Clast3, AW545363, Tnfsf5ip1, 1700017I17Rik
• Peptide Sequence: Synthetic peptide located within the following region: YLLTPCLQKSVQNKIKSLNWLEMEKSRCIPEMSDSEFCIRIPGGGITKTL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Psmg2 is a chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.
• Protein Interactions: Eed;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-Psmg2 (ARP67762_P050) antibody is Catalog # AAP67762
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Psmg2
• Uniprot ID: Q9EST4
• Protein Name: Proteasome assembly chaperone 2
• Protein Accession #: NP_598899
• Purification: Affinity Purified
• Nucleotide Accession #: NM_134138
• Tested Species Reactivity: Mouse
• Gene Symbol: Psmg2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Rabbit, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 83%; Goat: 86%; Guinea Pig: 92%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92%; Sheep: 92%
• Image 1: Mouse Liver
  
  Host: Rabbit
  Target Name: Psmg2
  Sample Type: Mouse Liver lysates
  Antibody Dilution: 1.0ug/ml