TLNRD1 Antibody - N-terminal region (ARP67656_P050)

• Product Number: ARP67656_P050
• Name: TLNRD1 Antibody - N-terminal region (ARP67656_P050)
• Protein Size (# AA): 362 amino acids
• Molecular Weight: 40kDa
• NCBI Gene Id: 59274
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: talin rod domain containing 1
• Alias Symbols: MESDC1
• Peptide Sequence: Synthetic peptide located within the following region: AIGGASSQPRKRLVSVCDHCKGKMQLVADLLLLSSEARPVLFEGPASSGA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a protein that is regulated by micro RNA MiR-574-3, and is thought to have an oncogenic function in human bladder cancer. A similar gene in mouse is located in a chromosomal region critical for differentiation of mesoderm, which affects embryo patterning and the formation of heart, muscle, blood, skeleton and the urogenital system. The mouse gene is expressed in early development, and in the adult.
• Protein Interactions: ELAVL1; LRP6;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TLNRD1 (ARP67656_P050) antibody is Catalog # AAP67656
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MESDC1
• Uniprot ID: Q9H1K6
• Protein Name: talin rod domain-containing protein 1
• Protein Accession #: NP_072088
• Purification: Affinity Purified
• Nucleotide Accession #: NM_022566
• Tested Species Reactivity: Human
• Gene Symbol: TLNRD1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 93%
• Image 1: Human HepG2
  
  Host: Rabbit
  Target Name: MESDC1
  Sample Type: HepG2 Whole Cell lysates
  Antibody Dilution: 1.0ug/ml