FAM108A1 Antibody - C-terminal region : FITC (ARP67573_P050-FITC)

Data Sheet
 
Product Number ARP67573_P050-FITC
Product Page www.avivasysbio.com/fam108a1-antibody-c-terminal-region-fitc-arp67573-p050-fitc.html
Name FAM108A1 Antibody - C-terminal region : FITC (ARP67573_P050-FITC)
Protein Size (# AA) 361 amino acids
Molecular Weight 39kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 81926
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols C19orf27, FAM108A1
Peptide Sequence Synthetic peptide located within the following region: VPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target The function of this protein remains unknown.
Protein Interactions HPGDS; UBC; Hoxa1;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-ABHD17A (ARP67573_P050-FITC) antibody
Blocking Peptide For anti-ABHD17A (ARP67573_P050-FITC) antibody is Catalog # AAP67573
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM108A1
Uniprot ID H2R6I8
Protein Name Uncharacterized protein Ensembl ENSPTRP00000049153
Sample Type Confirmation

ABHD17A is supported by BioGPS gene expression data to be expressed in HEK293T, Jurkat

Protein Accession # NP_112490
Purification Affinity Purified
Nucleotide Accession # NM_031213
Gene Symbol ABHD17A
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com