| Product Number |
ARP67573_P050 |
| Product Page |
www.avivasysbio.com/fam108a1-antibody-c-terminal-region-arp67573-p050.html |
| Name |
FAM108A1 Antibody - C-terminal region (ARP67573_P050) |
| Protein Size (# AA) |
361 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
81926 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Description |
|
| Alias Symbols |
C19orf27, FAM108A1 |
| Peptide Sequence |
Synthetic peptide located within the following region: VPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
HPGDS; UBC; Hoxa1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ABHD17A (ARP67573_P050) antibody |
| Blocking Peptide |
For anti-ABHD17A (ARP67573_P050) antibody is Catalog # AAP67573 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM108A1 |
| Uniprot ID |
H2R6I8 |
| Protein Name |
Uncharacterized protein Ensembl ENSPTRP00000049153 |
| Publications |
Temporal Profiling Establishes a Dynamic S-Palmitoylation Cycle. ACS Chem Biol. 13, 1560-1568 (2018). 29733200 |
| Sample Type Confirmation |
ABHD17A is supported by BioGPS gene expression data to be expressed in HEK293T, Jurkat |
| Protein Accession # |
NP_112490 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_031213 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ABHD17A |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human Fetal Brain
 | Host: Rabbit
Target Name: FAM108A1
Sample Type: Fetal Brain lysates
Antibody Dilution: 1.0ug/ml |
|
| Image 2 | Human Jurkat
 | Host: Rabbit
Target Name: FAM108A1
Sample Type: Human Jurkat
Antibody Dilution: 1.0ug/mlABHD17A is supported by BioGPS gene expression data to be expressed in Jurkat |
|
| Image 3 | Human 293T
 | Host: Rabbit
Target Name: FAM108A1
Sample Type: Human 293T
Antibody Dilution: 1.0ug/mlABHD17A is supported by BioGPS gene expression data to be expressed in HEK293T |
|
| Image 4 | Human Adult Placenta
 | Host: Rabbit
Target Name: FAM108A1
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml |
|
| Image 5 | Human Fetal Heart
 | Host: Rabbit
Target Name: FAM108A1
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml |
|
| Image 6 | Human Fetal Lung
 | Host: Rabbit
Target Name: FAM108A1
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml |
|
