| Product Number |
ARP67324_P050 |
| Product Page |
www.avivasysbio.com/thoc7-antibody-c-terminal-region-arp67324-p050.html |
| Name |
THOC7 Antibody - C-terminal region (ARP67324_P050) |
| Protein Size (# AA) |
204 amino acids |
| Molecular Weight |
22kDa |
| NCBI Gene Id |
80145 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
THO complex 7 homolog (Drosophila) |
| Alias Symbols |
fSAP24, hTREX30, NIF3L1BP1 |
| Peptide Sequence |
Synthetic peptide located within the following region: SVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
N/A |
| Description of Target |
THOC7 is required for efficient export of polyadenylated RNA. It acts as component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production. |
| Protein Interactions |
THOC2; RPA3; RPA2; RPA1; CKAP4; UBC; ZC3H15; TRMT112; PPIP5K2; THOC1; UBE3C; USP13; ZPR1; THOC5; VIM; S100A13; WDR36; ZCRB1; THOC3; ZNF606; THOC6; ALYREF; DDX39B; NIF3L1; CHD3; MED8; GOT2; MED18; MED22; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-THOC7 (ARP67324_P050) antibody |
| Blocking Peptide |
For anti-THOC7 (ARP67324_P050) antibody is Catalog # AAP67324 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human THOC7 |
| Uniprot ID |
Q6I9Y2 |
| Protein Name |
THO complex subunit 7 homolog |
| Protein Accession # |
NP_079351 |
| Purification |
Affinity purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
THOC7 |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Pig: 93%; Rabbit: 79%; Rat: 79% |
| Image 1 | Human 721_B Whole Cell
 | Host: Rabbit
Target Name: THOC7
Sample Type: 721_B Whole Cell lysates
Antibody Dilution: 1.0ug/ml |
|
