CADM4 Antibody - middle region : FITC (ARP66528_P050-FITC)

Data Sheet
 
Product Number ARP66528_P050-FITC
Product Page www.avivasysbio.com/cadm4-antibody-middle-region-fitc-arp66528-p050-fitc.html
Name CADM4 Antibody - middle region : FITC (ARP66528_P050-FITC)
Protein Size (# AA) 388 amino acids
Molecular Weight 42kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 199731
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols NECL4, TSLL2, IGSF4C, Necl-4, synCAM4
Peptide Sequence Synthetic peptide located within the following region: LRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target CADM4 is involved in the cell-cell adhesion. It has calcium- and magnesium-independent cell-cell adhesion activity. It may have tumor-suppressor activity.
Protein Interactions UBC; DYNC1I1; CSNK1E; CNKSR1;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-CADM4 (ARP66528_P050-FITC) antibody
Blocking Peptide For anti-CADM4 (ARP66528_P050-FITC) antibody is Catalog # AAP66528
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human CADM4
Uniprot ID Q8NFZ8
Protein Accession # NP_660339
Purification Affinity Purified
Nucleotide Accession # NM_145296
Gene Symbol CADM4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com