Product Number |
ARP65921_P050-FITC |
Product Page |
www.avivasysbio.com/lrrtm3-antibody-middle-region-fitc-arp65921-p050-fitc.html |
Name |
LRRTM3 Antibody - middle region : FITC (ARP65921_P050-FITC) |
Protein Size (# AA) |
513 amino acids |
Molecular Weight |
56kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
347731 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
LRRTM3, UNQ803/PRO1693, |
Peptide Sequence |
Synthetic peptide located within the following region: QLQQRSLMRRHRKKKRQSLKQMTPSTQEFYVDYKPTNTETSEMLLNGTGP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
LRRTM3 exhibits a limited synaptogenic activity in vitro, restricted to excitatory presynaptic differentiation. It may play a role in the development and maintenance of the vertebrate nervous system. |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-LRRTM3 (ARP65921_P050-FITC) antibody |
Blocking Peptide |
For anti-LRRTM3 (ARP65921_P050-FITC) antibody is Catalog # AAP65921 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human LRRTM3 |
Uniprot ID |
Q86VH5-2 |
Purification |
Affinity Purified |
Gene Symbol |
LRRTM3 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|