LRRTM3 Antibody - middle region : FITC (ARP65921_P050-FITC)

Data Sheet
 
Product Number ARP65921_P050-FITC
Product Page www.avivasysbio.com/lrrtm3-antibody-middle-region-fitc-arp65921-p050-fitc.html
Name LRRTM3 Antibody - middle region : FITC (ARP65921_P050-FITC)
Protein Size (# AA) 513 amino acids
Molecular Weight 56kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 347731
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols LRRTM3, UNQ803/PRO1693,
Peptide Sequence Synthetic peptide located within the following region: QLQQRSLMRRHRKKKRQSLKQMTPSTQEFYVDYKPTNTETSEMLLNGTGP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target LRRTM3 exhibits a limited synaptogenic activity in vitro, restricted to excitatory presynaptic differentiation. It may play a role in the development and maintenance of the vertebrate nervous system.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-LRRTM3 (ARP65921_P050-FITC) antibody
Blocking Peptide For anti-LRRTM3 (ARP65921_P050-FITC) antibody is Catalog # AAP65921
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human LRRTM3
Uniprot ID Q86VH5-2
Purification Affinity Purified
Gene Symbol LRRTM3
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com