Product Number |
ARP65781_P050-HRP |
Product Page |
www.avivasysbio.com/adgrl1-antibody-c-terminal-region-hrp-arp65781-p050-hrp.html |
Name |
ADGRL1 Antibody - C-terminal region : HRP (ARP65781_P050-HRP) |
Protein Size (# AA) |
839 amino acids |
Molecular Weight |
95kDa |
Conjugation |
HRP: Horseradish Peroxidase |
NCBI Gene Id |
22859 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
adhesion G protein-coupled receptor L1 |
Alias Symbols |
CL1, LEC2, CIRL1, LPHN1 |
Peptide Sequence |
Synthetic peptide located within the following region: YSLRSGDFPPGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAK |
Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Description of Target |
This gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cysteine-rich GPS (G-protein-coupled-receptor proteolysis site) domain resulted in two subunits (a large extracellular N-terminal cell adhesion subunit and a subunit with substantial similarity to the secretin/calcitonin family of GPCRs) being non-covalently bound at the cell membrane. Latrophilin-1 has been shown to recruit the neurotoxin from black widow spider venom, alpha-latrotoxin, to the synapse plasma membrane. Alternative splicing results in multiple variants encoding distinct isoforms. |
Protein Interactions |
PSMA3; ELAVL1; UBC; CACNA1A; APC; ANKS1A; SHANK1; SHANK2; DLG4; DLG3; ROS1; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-ADGRL1 (ARP65781_P050-HRP) antibody |
Blocking Peptide |
For anti-ADGRL1 (ARP65781_P050-HRP) antibody is Catalog # AAP65781 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human LPHN1 |
Uniprot ID |
O94910 |
Protein Name |
adhesion G protein-coupled receptor L1 |
Protein Accession # |
AAH07587 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001008701 |
Gene Symbol |
ADGRL1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100% |
Image 1 | |
|