| Product Number |
ARP65609_P050 |
| Product Page |
www.avivasysbio.com/selplg-antibody-c-terminal-region-arp65609-p050.html |
| Name |
SELPLG Antibody - C-terminal region (ARP65609_P050) |
| Protein Size (# AA) |
412 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
6404 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Selectin P ligand |
| Alias Symbols |
CLA, CD162, PSGL1, PSGL-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: EMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P-, E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes. As such, this protein plays a critical role in leukocyte trafficking during inflammation by tethering of leukocytes to activated platelets or endothelia expressing selectins. This protein requires two post-translational modifications, tyrosine sulfation and the addition of the sialyl Lewis x tetrasaccharide (sLex) to its O-linked glycans, for its high-affinity binding activity. Aberrant expression of this gene and polymorphisms in this gene are associated with defects in the innate and adaptive immune response. Alternate splicing results in multiple transcript variants. |
| Protein Interactions |
MAGEA1; TNIP1; PIK3R1; GALNT4; BACE1; TPST2; TPST1; SELL; SYK; MSN; SELP; SELE; VCAN; CTSG; SELPLG; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SELPLG (ARP65609_P050) antibody |
| Blocking Peptide |
For anti-SELPLG (ARP65609_P050) antibody is Catalog # AAP65609 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SELPLG |
| Uniprot ID |
Q14242 |
| Protein Name |
P-selectin glycoprotein ligand 1 |
| Protein Accession # |
NP_002997 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003006 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SELPLG |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 91%; Dog: 83%; Guinea Pig: 92%; Human: 100%; Rat: 83% |
| Image 1 | Human Fetal heart
 | WB Suggested Anti-SELPLG Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Heart |
|
|
