| Product Number |
ARP65409_P050 |
| Product Page |
www.avivasysbio.com/bcas1-antibody-c-terminal-region-arp65409-p050.html |
| Name |
BCAS1 Antibody - C-terminal region (ARP65409_P050) |
| Protein Size (# AA) |
584 amino acids |
| Molecular Weight |
62 kDa |
| NCBI Gene Id |
8537 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
breast carcinoma amplified sequence 1 |
| Alias Symbols |
AIBC1, NABC1, PMES-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: GAPQKGKEGSSKDKKSAAEMNKQKSNKQEAKEPAQCTEQATVDTNSLQNG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene resides in a region at 20q13 which is amplified in a variety of tumor types and associated with more aggressive tumor phenotypes. Among the genes identified from this region, it was found to be highly expressed in three amplified breast cancer cell lines and in one breast tumor without amplification at 20q13.2. However, this gene is not in the common region of maximal amplification and its expression was not detected in the breast cancer cell line MCF7, in which this region is highly amplified. Although not consistently expressed, this gene is a candidate oncogene. Two transcript variants encoding different isoforms have been found for this gene. |
| Protein Interactions |
DYNLL1; BCAS1; RUVBL2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ADT1 (ARP65409_P050) antibody |
| Blocking Peptide |
For anti-BCAS1 (ARP65409_P050) antibody is Catalog # AAP65409 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human BCAS1 |
| Uniprot ID |
O75363 |
| Protein Name |
breast carcinoma-amplified sequence 1 |
| Protein Accession # |
NP_003648 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_003657.2 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
BCAS1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 92%; Horse: 100%; Human: 100%; Pig: 100%; Rat: 79% |
| Image 1 | Human Testicular Tumor
 | Host: Rabbit
Target Name: BCAS1
Sample Tissue: Human Testicular Tumor lysates
Antibody Dilution: 1ug/ml |
|
|
