HBG2 Antibody - middle region : FITC (ARP64733_P050-FITC)

Data Sheet
 
Product Number ARP64733_P050-FITC
Product Page www.avivasysbio.com/hbg2-antibody-middle-region-fitc-arp64733-p050-fitc.html
Name HBG2 Antibody - middle region : FITC (ARP64733_P050-FITC)
Protein Size (# AA) 147 amino acids
Molecular Weight 16kDa
Subunit gamma-2
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 3048
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Hemoglobin, gamma G
Alias Symbols TNCY, HBG-T1
Peptide Sequence Synthetic peptide located within the following region: MGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'- epsilon -- gamma-G -- gamma-A -- delta -- beta--3'.
Protein Interactions VCAM1; SMAD5; RPSA; ITGA4; APP; CYB5R3; HBG2; HBB;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-HBG2 (ARP64733_P050-FITC) antibody
Blocking Peptide For anti-HBG2 (ARP64733_P050-FITC) antibody is Catalog # AAP64733
Uniprot ID P69892
Protein Name Hemoglobin subunit gamma-2
Protein Accession # NP_000175
Purification Affinity Purified
Nucleotide Accession # NM_000184
Gene Symbol HBG2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 77%; Goat: 100%; Guinea Pig: 77%; Horse: 77%; Human: 100%; Mouse: 83%; Pig: 93%; Rabbit: 75%; Rat: 83%; Sheep: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com