HBG2 Antibody - middle region (ARP64733_P050)

• Product Number: ARP64733_P050
• Name: HBG2 Antibody - middle region (ARP64733_P050)
• Protein Size (# AA): 147 amino acids
• Molecular Weight: 16kDa
• Subunit: gamma-2
• NCBI Gene Id: 3048
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Hemoglobin, gamma G
• Alias Symbols: TNCY, HBG-T1
• Peptide Sequence: Synthetic peptide located within the following region: MGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'- epsilon -- gamma-G -- gamma-A -- delta -- beta--3'.
• Protein Interactions: VCAM1; SMAD5; RPSA; ITGA4; APP; CYB5R3; HBG2; HBB;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HBG2 (ARP64733_P050) antibody is Catalog # AAP64733
• Uniprot ID: P69892
• Protein Name: Hemoglobin subunit gamma-2
• Protein Accession #: NP_000175
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000184
• Tested Species Reactivity: Human
• Gene Symbol: HBG2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 77%; Goat: 100%; Guinea Pig: 77%; Horse: 77%; Human: 100%; Mouse: 83%; Pig: 93%; Rabbit: 75%; Rat: 83%; Sheep: 100%
• Image 1: Human Fetal Kidney
  
  WB Suggested Anti-HBG2 Antibody
  Titration: 1.0 ug/ml
  Positive Control: Fetal Kidney
• Image 2: Human Fetal Lung
  
  Host: Rabbit
  Target Name: NSUN6
  Sample Type: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml
• Image 3: Human Fetal Liver
  
  Host: Rabbit
  Target Name: FAM46C
  Sample Type: Human Fetal Liver
  Antibody Dilution: 1.0ug/ml
• Image 4: Human Adult Placenta
  
  Host: Rabbit
  Target Name: SERPINA3
  Sample Type: Human Adult Placenta
  Antibody Dilution: 1.0ug/ml