| Product Number |
ARP64683_P050 |
| Product Page |
www.avivasysbio.com/cilp-antibody-c-terminal-region-arp64683-p050.html |
| Name |
CILP Antibody - C-terminal region (ARP64683_P050) |
| Protein Size (# AA) |
1184 amino acids |
| Molecular Weight |
52kDa |
| NCBI Gene Id |
8483 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cartilage intermediate layer protein, nucleotide pyrophosphohydrolase |
| Alias Symbols |
CILP-1, HsT18872 |
| Peptide Sequence |
Synthetic peptide located within the following region: YIKVKIVGPLEVNVRSRNMGGTHRQTVGKLYGIRDVRSTRDRDQPNVSAA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Major alterations in the composition of the cartilage extracellular matrix occur in joint disease, such as osteoarthrosis. This gene encodes the cartilage intermediate layer protein (CILP), which increases in early osteoarthrosis cartilage. The encoded protein was thought to encode a protein precursor for two different proteins; an N-terminal CILP and a C-terminal homolog of NTPPHase, however, later studies identified no nucleotide pyrophosphatase phosphodiesterase (NPP) activity. The full-length and the N-terminal domain of this protein was shown to function as an IGF-1 antagonist. An allelic variant of this gene has been associated with lumbar disc disease. |
| Protein Interactions |
NEDD1; CDC20; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CILP (ARP64683_P050) antibody |
| Blocking Peptide |
For anti-CILP (ARP64683_P050) antibody is Catalog # AAP64683 |
| Uniprot ID |
O75339 |
| Protein Name |
Cartilage intermediate layer protein 1 |
| Protein Accession # |
NP_003604 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003613 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CILP |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human 721_B
 | WB Suggested Anti-CILP Antibody
Titration: 1.0 ug/ml
Positive Control: 721_B Whole Cell |
|
|
