Product Number |
ARP64673_P050-FITC |
Product Page |
www.avivasysbio.com/rfk-antibody-n-terminal-region-fitc-arp64673-p050-fitc.html |
Name |
RFK Antibody - N-terminal region : FITC (ARP64673_P050-FITC) |
Protein Size (# AA) |
155 amino acids |
Molecular Weight |
17 kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
55312 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
riboflavin kinase |
Alias Symbols |
RIFK |
Peptide Sequence |
Synthetic peptide located within the following region: ASVGSGDVHKMVVSIGWNPYYKNTKKSMETHIMHTFKEDFYGEILNVAIV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
Riboflavin kinase is an essential enzyme that catalyzes the phosphorylation of riboflavin (vitamin B2) to form flavin mononucleotide (FMN), an obligatory step in vitamin B2 utilization and flavin cofactor synthesi. |
Protein Interactions |
UBC; DNAJB9; RAB1A; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-RFK (ARP64673_P050-FITC) antibody |
Blocking Peptide |
For anti-RFK (ARP64673_P050-FITC) antibody is Catalog # AAP64673 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RFK |
Uniprot ID |
Q969G6 |
Protein Name |
Riboflavin kinase |
Protein Accession # |
NP_060809 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_018339.5 |
Gene Symbol |
RFK |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%; Yeast: 100%; Zebrafish: 100% |
Image 1 | |
|