RFK Antibody - N-terminal region : FITC (ARP64673_P050-FITC)

Data Sheet
 
Product Number ARP64673_P050-FITC
Product Page www.avivasysbio.com/rfk-antibody-n-terminal-region-fitc-arp64673-p050-fitc.html
Name RFK Antibody - N-terminal region : FITC (ARP64673_P050-FITC)
Protein Size (# AA) 155 amino acids
Molecular Weight 17 kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 55312
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name riboflavin kinase
Alias Symbols RIFK
Peptide Sequence Synthetic peptide located within the following region: ASVGSGDVHKMVVSIGWNPYYKNTKKSMETHIMHTFKEDFYGEILNVAIV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target Riboflavin kinase is an essential enzyme that catalyzes the phosphorylation of riboflavin (vitamin B2) to form flavin mononucleotide (FMN), an obligatory step in vitamin B2 utilization and flavin cofactor synthesi.
Protein Interactions UBC; DNAJB9; RAB1A;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-RFK (ARP64673_P050-FITC) antibody
Blocking Peptide For anti-RFK (ARP64673_P050-FITC) antibody is Catalog # AAP64673
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RFK
Uniprot ID Q969G6
Protein Name Riboflavin kinase
Protein Accession # NP_060809
Purification Affinity purified
Nucleotide Accession # NM_018339.5
Gene Symbol RFK
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%; Yeast: 100%; Zebrafish: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com