| Product Number |
ARP64646_P050 |
| Product Page |
www.avivasysbio.com/cacna2d2-antibody-c-terminal-region-arp64646-p050.html |
| Name |
CACNA2D2 Antibody - C-terminal region (ARP64646_P050) |
| Protein Size (# AA) |
1143 amino acids |
| Molecular Weight |
129kDa |
| Subunit |
alpha-2/delta-2 |
| NCBI Gene Id |
9254 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
CASVDD, CACNA2D |
| Peptide Sequence |
Synthetic peptide located within the following region: NCSRLFHAQRLTNTNLLFVVAEKPLCSQCEAGRLLQKETHSDGPEQCELV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a member of the alpha-2/delta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. Research on a highly similar protein in rabbit suggests the protein described in this record is cleaved into alpha-2 and delta subunits. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CACNA2D2 (ARP64646_P050) antibody |
| Blocking Peptide |
For anti-CACNA2D2 (ARP64646_P050) antibody is Catalog # AAP64646 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CACNA2D2 |
| Uniprot ID |
Q9NY47 |
| Protein Accession # |
NP_006021 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006030 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CACNA2D2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 76%; Dog: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 81%; Rat: 81% |
| Image 1 | Human HCT15
 | WB Suggested Anti-CACNA2D2 Antibody
Titration: 1.0 ug/ml
Positive Control: HCT15 Whole Cell |
|
|
