GPIHBP1 Antibody - C-terminal region (ARP64479_P050)

• Product Number: ARP64479_P050
• Name: GPIHBP1 Antibody - C-terminal region (ARP64479_P050)
• Protein Size (# AA): 184 amino acids
• Molecular Weight: 18kDa
• NCBI Gene Id: 338328
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
• Alias Symbols: HYPL1D, GPI-HBP1
• Peptide Sequence: Synthetic peptide located within the following region: QVTMTCCQSSLCNVPPWQSSRVQDPTGKGAGGPRGSSETVGAALLLNLLA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Dietary fats are packaged by intestine into triglyceride-rich lipoproteins called chylomicrons. The triglycerides in chylomicrons are hydrolyzed by lipoprotein lipase (LPL: MIM 609708) along the luminal surface of capillaries, mainly in heart, skeletal muscle, and adipose tissue. GPIHBP1 is a capillary endothelial cell protein that provides a platform for LPL-mediated processing of chylomicrons.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GPIHBP1 (ARP64479_P050) antibody is Catalog # AAP64479
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPIHBP1
• Uniprot ID: Q8IV16
• Protein Name: Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1
• Protein Accession #: NP_835466
• Purification: Affinity Purified
• Nucleotide Accession #: NM_178172
• Tested Species Reactivity: Human
• Gene Symbol: GPIHBP1
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-GPIHBP1 Antibody
  Titration: 1.0 ug/ml
  Positive Control: HepG2 Whole Cell