| Product Number |
ARP64372_P050 |
| Product Page |
www.avivasysbio.com/ormdl3-antibody-n-terminal-region-arp64372-p050.html |
| Name |
ORMDL3 Antibody - N-terminal region (ARP64372_P050) |
| Protein Size (# AA) |
153 amino acids |
| Molecular Weight |
17kDa |
| NCBI Gene Id |
94103 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ORM1-like 3 (S. cerevisiae) |
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: GTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
ORMDL3 is a negative regulator of sphingolipid synthesis. ORMDL3 may indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling. |
| Protein Interactions |
UBC; APP; LNX1; ELAVL1; SPTLC1; EEF1A1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ORMDL3 (ARP64372_P050) antibody |
| Specificity |
Pan specific ORMDL1-3 antibody. Predicted to react with ORMDL1, ORMDL2 and ORMDL3. |
| Blocking Peptide |
For anti-ORMDL3 (ARP64372_P050) antibody is Catalog # AAP64372 |
| Uniprot ID |
Q8N138 |
| Protein Name |
ORM1-like protein 3 |
| Protein Accession # |
NP_644809 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_139280 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ORMDL3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ORMDL3 Antibody
Titration: 1.0 ug/ml
Positive Control: Jurkat Whole Cell |
|
| Image 2 | HepG2 Cell Lysate, THP1 Cell Lysate
 | Host: Rabbit
Target: ORMDL3
Positive control (+): HepG2 Cell Lysate (HG)
Negative control (-): THP1 Cell Lysate (N30)
Antibody concentration: 4ug/ml |
|
| Image 3 | Human HepG2 Whole Cell
 | Host: Rabbit
Target Name: ORMDL3
Sample Tissue: Human HepG2 Whole Cell
Antibody Dilution: 1ug/ml |
|
