Product Number |
ARP64265_P050-Biotin |
Product Page |
www.avivasysbio.com/spam1-antibody-middle-region-biotin-arp64265-p050-biotin.html |
Name |
SPAM1 Antibody - middle region : Biotin (ARP64265_P050-Biotin) |
Protein Size (# AA) |
509 amino acids |
Molecular Weight |
55kDa |
Conjugation |
Biotin |
NCBI Gene Id |
6677 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
HYA1, PH20, HYAL1, HYAL3, HYAL5, PH-20, SPAG15, HEL-S-96n |
Peptide Sequence |
Synthetic peptide located within the following region: QQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYYLFP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene was previously referred to as HYAL1 and HYA1 and has since been assigned the official symbol SPAM1; another family member on chromosome 3p21.3 has been assigned HYAL1. This gene encodes a GPI-anchored enzyme located on the human sperm surface and inner acrosomal membrane. This multifunctional protein is a hyaluronidase that enables sperm to penetrate through the hyaluronic acid-rich cumulus cell layer surrounding the oocyte, a receptor that plays a role in hyaluronic acid induced cell signaling, and a receptor that is involved in sperm-zona pellucida adhesion. Abnormal expression of this gene in tumors has implicated this protein in degradation of basement membranes leading to tumor invasion and metastasis. Multiple transcript variants encoding different isoforms have been found for this gene. |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-SPAM1 (ARP64265_P050-Biotin) antibody |
Blocking Peptide |
For anti-SPAM1 (ARP64265_P050-Biotin) antibody is Catalog # AAP64265 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human SPAM1 |
Uniprot ID |
P38567 |
Protein Accession # |
NP_694859 |
Purification |
Affinity Purified |
Gene Symbol |
SPAM1 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|