SPAM1 Antibody - C-terminal region (ARP64264_P050)

• Product Number: ARP64264_P050
• Name: SPAM1 Antibody - C-terminal region (ARP64264_P050)
• Protein Size (# AA): 509 amino acids
• Molecular Weight: 58kDa
• NCBI Gene Id: 6677
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: HYA1, PH20, HYAL1, HYAL3, HYAL5, PH-20, SPAG15, HEL-S-96n
• Peptide Sequence: Synthetic peptide located within the following region: CYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene was previously referred to as HYAL1 and HYA1 and has since been assigned the official symbol SPAM1; another family member on chromosome 3p21.3 has been assigned HYAL1. This gene encodes a GPI-anchored enzyme located on the human sperm surface and inner acrosomal membrane. This multifunctional protein is a hyaluronidase that enables sperm to penetrate through the hyaluronic acid-rich cumulus cell layer surrounding the oocyte, a receptor that plays a role in hyaluronic acid induced cell signaling, and a receptor that is involved in sperm-zona pellucida adhesion. Abnormal expression of this gene in tumors has implicated this protein in degradation of basement membranes leading to tumor invasion and metastasis. Multiple transcript variants encoding different isoforms have been found for this gene.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SPAM1 (ARP64264_P050) antibody is Catalog # AAP64264
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SPAM1
• Uniprot ID: P38567
• Protein Name: Hyaluronidase PH-20
• Protein Accession #: NP_694859
• Purification: Affinity Purified
• Nucleotide Accession #: NM_153189
• Tested Species Reactivity: Human
• Gene Symbol: SPAM1
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human Adult Placenta
  
  Host: Rabbit
  Target Name: SPAM1
  Sample Type: Human Adult Placenta
  Antibody Dilution: 1.0ug/ml
• Image 2: Human 293T
  
  Host: Rabbit
  Target Name: SPAM1
  Sample Type: 293T
  Antibody Dilution: 1.0ug/ml
• Image 3: Human Jurkat
  
  WB Suggested Anti-SPAM1 Antibody
  Titration: 1.0 ug/ml
  Positive Control: Jurkat Whole Cell
• Image 4: Human A549 Whole Cell
  
  Host: Rabbit
  Target Name: SPAM1
  Sample Tissue: Human A549 Whole Cell
  Antibody Dilution: 3ug/ml
• Image 5: Human Jurkat Whole Cell
  
  Host: Rabbit
  Target Name: SPAM1
  Sample Tissue: Human Jurkat Whole Cell
  Antibody Dilution: 3ug/ml
• Image 6: Human HT1080 Whole Cell
  
  Host: Rabbit
  Target Name: SPAM1
  Sample Tissue: Human HT1080 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 7: Human HepG2 Whole Cell
  
  Host: Rabbit
  Target Name: SPAM1
  Sample Tissue: Human HepG2 Whole Cell
  Antibody Dilution: 0.2ug/ml
• Image 8:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.