MYO10 Antibody - C-terminal region (ARP64209_P050)

Data Sheet
 
Product Number ARP64209_P050
Product Page www.avivasysbio.com/myo10-antibody-c-terminal-region-arp64209-p050.html
Name MYO10 Antibody - C-terminal region (ARP64209_P050)
Protein Size (# AA) 984 amino acids
Molecular Weight 110kDa
NCBI Gene Id 4651
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Myosin X
Alias Symbols -
Peptide Sequence Synthetic peptide located within the following region: TYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTTRSASSQGSSR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a member of the myosin superfamily. The protein represents an unconventional myosin; it should not be confused with the conventional non-muscle myosin-10 (MYH10). Unconventional myosins contain the basic domains of conventional myosins and are further distinguished from class members by their tail domains. This gene functions as an actin-based molecular motor and plays a role in integration of F-actin and microtubule cytoskeletons during meiosis.
Protein Interactions UBC; PAN2; CAND1; KIAA0368; PRKCI; TERF2; FBXW11; PLA2G10; DYNLL1; ITGB5; CALML3; CALM1; ACTA1; CALM3; ITGB1; ITGB3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MYO10 (ARP64209_P050) antibody
Blocking Peptide For anti-MYO10 (ARP64209_P050) antibody is Catalog # AAP64209
Uniprot ID Q8NCI3
Protein Name cDNA FLJ90236 fis, clone NT2RM2000589, moderately similar to Bos taurus myosin X EMBL BAC11158.1
Protein Accession # BAC11158
Purification Affinity Purified
Nucleotide Accession # NM_012334
Tested Species Reactivity Human
Gene Symbol MYO10
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 93%
Image 1
Human 293T
WB Suggested Anti-MYO10 Antibody
Titration: 1.0 ug/ml
Positive Control: 293T Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com