| Product Number |
ARP64152_P050 |
| Product Page |
www.avivasysbio.com/wisp2-antibody-c-terminal-region-arp64152-p050.html |
| Name |
WISP2 Antibody - C-terminal region (ARP64152_P050) |
| Protein Size (# AA) |
250 amino acids |
| Molecular Weight |
24kDa |
| NCBI Gene Id |
8839 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
WNT1 inducible signaling pathway protein 2 |
| Alias Symbols |
CT58, WISP2, CTGF-L |
| Peptide Sequence |
Synthetic peptide located within the following region: WGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like (CT) domain. The encoded protein lacks the CT domain which is implicated in dimerization and heparin binding. It is 72% identical to the mouse protein at the amino acid level. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. Its expression in colon tumors is reduced while the other two WISP members are overexpressed in colon tumors. It is expressed at high levels in bone tissue, and may play an important role in modulating bone turnover. |
| Protein Interactions |
HDAC3; HDAC1; IGF1R; IGF2R; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-WISP2 (ARP64152_P050) antibody |
| Blocking Peptide |
For anti-WISP2 (ARP64152_P050) antibody is Catalog # AAP64152 |
| Uniprot ID |
O76076 |
| Protein Name |
WNT1-inducible-signaling pathway protein 2 |
| Sample Type Confirmation |
WISP2 is supported by BioGPS gene expression data to be expressed in HeLa |
| Protein Accession # |
NP_003872 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003881 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
WISP2 |
| Predicted Species Reactivity |
Human, Rat, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 79%; Horse: 79%; Human: 100%; Pig: 79%; Rat: 79% |
| Image 1 | Human Placenta
 | Host: Rabbit
Target Name: WISP2
Antibody Dilution: 1.0ug/ml
Sample Type: Human Placenta |
| | Image 2 | Human HeLa
 | HeLaWISP2 is supported by BioGPS gene expression data to be expressed in HeLa |
|
|
