MYOT Antibody - C-terminal region : HRP (ARP64117_P050-HRP)

Data Sheet
 
Product Number ARP64117_P050-HRP
Product Page https://www.avivasysbio.com/myot-antibody-c-terminal-region-hrp-arp64117-p050-hrp.html
Name MYOT Antibody - C-terminal region : HRP (ARP64117_P050-HRP)
Protein Size (# AA) 498 amino acids
Molecular Weight 55kDa
Conjugation HRP: Horseradish Peroxidase
NCBI Gene Id 9499
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Myotilin
Alias Symbols MFM3, TTID, TTOD, LGMD1, LGMD1A
Peptide Sequence Synthetic peptide located within the following region: RNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTT
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Description of Target This gene encodes a cystoskeletal protein which plays a significant role in the stability of thin filaments during muscle contraction. This protein binds F-actin, crosslinks actin filaments, and prevents latrunculin A-induced filament disassembly. Mutations in this gene have been associated with limb-girdle muscular dystrophy and myofibrillar myopathies. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Protein Interactions NME7; TRIM63; TRIM55; GPRASP2; TFG; AXIN1; APP; LRP12; MYOT; FLNA; ACTN1; FLNC; ST7;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-MYOT (ARP64117_P050-HRP) antibody
Blocking Peptide For anti-MYOT (ARP64117_P050-HRP) antibody is Catalog # AAP64117
Uniprot ID Q9UBF9
Protein Name Myotilin
Protein Accession # NP_006781
Purification Affinity Purified
Nucleotide Accession # NM_006790
Gene Symbol MYOT
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1