CCKAR Antibody - N-terminal region : FITC (ARP64107_P050-FITC)

Data Sheet
 
Product Number ARP64107_P050-FITC
Product Page www.avivasysbio.com/cckar-antibody-n-terminal-region-fitc-arp64107-p050-fitc.html
Name CCKAR Antibody - N-terminal region : FITC (ARP64107_P050-FITC)
Protein Size (# AA) 428 amino acids
Molecular Weight 48kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 886
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cholecystokinin A receptor
Alias Symbols CCK-A, CCK1R, CCKRA, CCK1-R
Peptide Sequence Synthetic peptide located within the following region: GLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target This gene encodes a G-protein coupled receptor that binds non-sulfated members of the cholecystokinin (CCK) family of peptide hormones. This receptor is a major physiologic mediator of pancreatic enzyme secretion and smooth muscle contraction of the gallbladder and stomach. In the central and peripheral nervous system this receptor regulates satiety and the release of beta-endorphin and dopamine.
Protein Interactions CCKBR; CCKAR; CCK;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-CCKAR (ARP64107_P050-FITC) antibody
Blocking Peptide For anti-CCKAR (ARP64107_P050-FITC) antibody is Catalog # AAP64107
Uniprot ID P32238
Protein Name Cholecystokinin receptor type A
Protein Accession # NP_000721
Purification Affinity Purified
Nucleotide Accession # NM_000730
Gene Symbol CCKAR
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 85%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com