Product Number |
ARP64107_P050-Biotin |
Product Page |
www.avivasysbio.com/cckar-antibody-n-terminal-region-biotin-arp64107-p050-biotin.html |
Name |
CCKAR Antibody - N-terminal region : Biotin (ARP64107_P050-Biotin) |
Protein Size (# AA) |
428 amino acids |
Molecular Weight |
48kDa |
Conjugation |
Biotin |
NCBI Gene Id |
886 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Cholecystokinin A receptor |
Alias Symbols |
CCK-A, CCK1R, CCKRA, CCK1-R |
Peptide Sequence |
Synthetic peptide located within the following region: GLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
This gene encodes a G-protein coupled receptor that binds non-sulfated members of the cholecystokinin (CCK) family of peptide hormones. This receptor is a major physiologic mediator of pancreatic enzyme secretion and smooth muscle contraction of the gallbladder and stomach. In the central and peripheral nervous system this receptor regulates satiety and the release of beta-endorphin and dopamine. |
Protein Interactions |
CCKBR; CCKAR; CCK; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-CCKAR (ARP64107_P050-Biotin) antibody |
Blocking Peptide |
For anti-CCKAR (ARP64107_P050-Biotin) antibody is Catalog # AAP64107 |
Uniprot ID |
P32238 |
Protein Name |
Cholecystokinin receptor type A |
Protein Accession # |
NP_000721 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000730 |
Gene Symbol |
CCKAR |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 85% |
Image 1 | |
|