Product Number |
ARP64107_P050 |
Product Page |
www.avivasysbio.com/cckar-antibody-n-terminal-region-arp64107-p050.html |
Name |
CCKAR Antibody - N-terminal region (ARP64107_P050) |
Protein Size (# AA) |
428 amino acids |
Molecular Weight |
48kDa |
NCBI Gene Id |
886 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Cholecystokinin A receptor |
Alias Symbols |
CCK-A, CCK1R, CCKRA, CCK1-R |
Peptide Sequence |
Synthetic peptide located within the following region: GLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a G-protein coupled receptor that binds non-sulfated members of the cholecystokinin (CCK) family of peptide hormones. This receptor is a major physiologic mediator of pancreatic enzyme secretion and smooth muscle contraction of the gallbladder and stomach. In the central and peripheral nervous system this receptor regulates satiety and the release of beta-endorphin and dopamine. |
Protein Interactions |
CCKBR; CCKAR; CCK; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CCKAR (ARP64107_P050) antibody |
Blocking Peptide |
For anti-CCKAR (ARP64107_P050) antibody is Catalog # AAP64107 |
Uniprot ID |
P32238 |
Protein Name |
Cholecystokinin receptor type A |
Protein Accession # |
NP_000721 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000730 |
Tested Species Reactivity |
Human |
Gene Symbol |
CCKAR |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 85% |
Image 1 | Human MCF-7
| WB Suggested Anti-CCKAR Antibody Titration: 1.0 ug/ml Positive Control: MCF7 Whole Cell |
|
|