CCKAR Antibody - N-terminal region (ARP64107_P050)

Data Sheet
 
Product Number ARP64107_P050
Product Page www.avivasysbio.com/cckar-antibody-n-terminal-region-arp64107-p050.html
Product Name CCKAR Antibody - N-terminal region (ARP64107_P050)
Size 100 ul
Gene Symbol CCKAR
Alias Symbols CCK-A, CCK1-R, CCKRA
Protein Size (# AA) 428 amino acids
Molecular Weight 48kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 886
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Cholecystokinin A receptor
Peptide Sequence Synthetic peptide located within the following region: GLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNK
Description of Target This gene encodes a G-protein coupled receptor that binds non-sulfated members of the cholecystokinin (CCK) family of peptide hormones. This receptor is a major physiologic mediator of pancreatic enzyme secretion and smooth muscle contraction of the gallbladder and stomach. In the central and peripheral nervous system this receptor regulates satiety and the release of beta-endorphin and dopamine.
Protein Interactions CCKBR; CCKAR; CCK;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-CCKAR (ARP64107_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-CCKAR (ARP64107_P050) antibody is Catalog # AAP64107
Complete computational species homology data Anti-CCKAR (ARP64107_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CCKAR.
Swissprot Id P32238
Protein Name Cholecystokinin receptor type A
Protein Accession # NP_000721
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CCKAR.
Nucleotide Accession # NM_000730
Replacement Item This antibody may replace item sc-16172 from Santa Cruz Biotechnology.
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 85%
Image 1
Human MCF-7
WB Suggested Anti-CCKAR Antibody
Titration: 1.0 ug/ml
Positive Control: MCF7 Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com