CCKAR Antibody - N-terminal region (ARP64107_P050)

Data Sheet
 
Product Number ARP64107_P050
Product Page www.avivasysbio.com/cckar-antibody-n-terminal-region-arp64107-p050.html
Name CCKAR Antibody - N-terminal region (ARP64107_P050)
Protein Size (# AA) 428 amino acids
Molecular Weight 48kDa
NCBI Gene Id 886
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cholecystokinin A receptor
Alias Symbols CCK-A, CCK1R, CCKRA, CCK1-R
Peptide Sequence Synthetic peptide located within the following region: GLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a G-protein coupled receptor that binds non-sulfated members of the cholecystokinin (CCK) family of peptide hormones. This receptor is a major physiologic mediator of pancreatic enzyme secretion and smooth muscle contraction of the gallbladder and stomach. In the central and peripheral nervous system this receptor regulates satiety and the release of beta-endorphin and dopamine.
Protein Interactions CCKBR; CCKAR; CCK;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CCKAR (ARP64107_P050) antibody
Blocking Peptide For anti-CCKAR (ARP64107_P050) antibody is Catalog # AAP64107
Uniprot ID P32238
Protein Name Cholecystokinin receptor type A
Protein Accession # NP_000721
Purification Affinity Purified
Nucleotide Accession # NM_000730
Tested Species Reactivity Human
Gene Symbol CCKAR
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 85%
Image 1
Human MCF-7
WB Suggested Anti-CCKAR Antibody
Titration: 1.0 ug/ml
Positive Control: MCF7 Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com