| Product Number |
ARP64034_P050 |
| Product Page |
www.avivasysbio.com/sftpa2-antibody-n-terminal-region-arp64034-p050.html |
| Name |
SFTPA2 Antibody - N-terminal region (ARP64034_P050) |
| Protein Size (# AA) |
248 amino acids |
| Molecular Weight |
26kDa |
| NCBI Gene Id |
729238 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Surfactant protein A2 |
| Alias Symbols |
PSAP, PSPA, SP-A, SPA2, PSP-A, SFTP1, SP-2A, SPAII, COLEC5, SFTPA2B |
| Peptide Sequence |
Synthetic peptide located within the following region: PGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQIL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication. |
| Protein Interactions |
SFTPA2; SFTPA1; CD93; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SFTPA2 (ARP64034_P050) antibody |
| Blocking Peptide |
For anti-SFTPA2 (ARP64034_P050) antibody is Catalog # AAP64034 |
| Uniprot ID |
Q8IWL1 |
| Protein Name |
Pulmonary surfactant-associated protein A2 |
| Protein Accession # |
NP_001092138 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001098668 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SFTPA2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 92%; Goat: 91%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 86%; Sheep: 93%; Zebrafish: 85% |
| Image 1 | Human Fetal heart
 | WB Suggested Anti-SFTPA2 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Heart |
|
| Image 2 | Human , Mouse, Rat
 | Lanes:
1: 20ng human SP-A2 protein,
2: 20ug rat wt BAL cell lysate,
3: 25ng hSP-A2 (1A0) protein purified from transfected CHO lysate,
4: 25ng hSP-A2 (1A1) protein purified from transfected CHO lysate,
5: 25ng hSP-A1 (6A2) protein purified from transfected CHO lysate,
6: 25ng hSP-A1 (6A4) protein purified from transfected CHO lysate,
7: 25ng hSP-A2/1 (1A0/6A4) protein purified from transfected CHO lysate,
8: 25ng hSP-A2/1 (1A1/6A2) protein purified from transfected CHO lysate,
9: 20ug SP-A KO mouse BAL lysate,
10: 25ng hSP-A2 (1A0) protein purified from transfected mouse BAL lysate,
11: 25ng hSP-A2 (1A1) protein purified from transfected mouse BAL lysate,
12: 25ng hSP-A1 (6A2) protein purified from transfected mouse BAL lysate,
13: 25ng hSP-A1 (6A4) protein purified from transfected mouse BAL lysate,
14: 25ng hSP-A2/1 (1A0/6A2) protein purified from transfected mouse BAL lysate,
15: 25ng mouse SP-A2 protein purified from mouse BAL lysate,
16: 20ug mouse wt BAL lysate,
17: 15ug human wt T2 lysate,
18: 25ng human SP-A2 protein. |
|
| Image 3 | Human Alveolar
 | Lanes:
Lane 1: 25ng purified Human Alveolar sample (w/SP-A1+SP-A2)
Lane 1: 25ng purified Human Alveolar sample (w/SP-A1+SP-A2)
Lane 2: 20ug Rat bronchoalveolar lavage
Lane 3: 25ng hSP-A2 variant expressed in CHO cells
Lane 4: 25ng hSP-A2 variant expressed in CHO cells
Lane 5: 25ng hSP-A1/A2 variants expressed in CHO cells
Lane 6: 25ng hSP-A1/A2 variants expressed in CHO cells
Lane 7: 20ug SP-A1/2 KO mouse bronchoalveolar lavage
Lane 8: 20ug hSP-A2 variant transgenic mouse bronchoalveolar lavage
Lane 9: 20ug hSP-A2 variant transgenic mouse bronchoalveolar lavage
Lane 10: 20ug hSP-A1 variant transgenic mouse bronchoalveolar lavage
Lane 11: 20ug hSP-A1 variant transgenic mouse bronchoalveolar lavage
Lane 12: 20ug hSP-A1/A2 variants transgenic mouse bronchoalveolar lavage
Lane 13: 20ug mSP-A1/A2 bronchoalveolar lavage; +/- mouse
Lane 14: 20ug mSP-A1/A2 bronchoalveolar lavage; WT mouse
Lane 15: 10ug human alveolar cell lysate
Lane 16: 25ng purified hSP-A1/A2
Primary Antibody Dilution:
1:2500
Secondary Antibody:
IgG HRP Conj
Secondary Antibody Dilution:
1:10000
Gene Name:
SFTPA2
Submitted by:
Todd M. Umstead, Pennsylvania State University College of Medicine
|
|
