Product Number |
ARP63674_P050 |
Product Page |
https://www.avivasysbio.com/pgm2-antibody-c-terminal-region-arp63674-p050.html |
Name |
PGM2 Antibody - C-terminal region (ARP63674_P050) |
Protein Size (# AA) |
612 amino acids |
Molecular Weight |
67kDa |
NCBI Gene Id |
55276 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Phosphoglucomutase 2 |
Alias Symbols |
MSTP006 |
Peptide Sequence |
Synthetic peptide located within the following region: AIRDLTTGYDDSQPDKKAVLPTSKSSQMITFTFANGGVATMRTSGTEPKI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
PGM2 catalyzes the conversion of the nucleoside breakdown products ribose-1-phosphate and deoxyribose-1-phosphate to the corresponding 5-phosphopentoses. PGM2 may also catalyze the interconversion of glucose-1-phosphate and glucose-6-phosphate. PGM2 has low glucose 1,6-bisphosphate synthase activity. |
Protein Interactions |
UBC; BAG3; PGM1; ACD; TINF2; POT1; TERF1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PGM2 (ARP63674_P050) antibody |
Blocking Peptide |
For anti-PGM2 (ARP63674_P050) antibody is Catalog # AAP63674 |
Uniprot ID |
Q96G03 |
Protein Name |
Phosphoglucomutase-2 |
Protein Accession # |
NP_060760 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_018290 |
Tested Species Reactivity |
Human |
Gene Symbol |
PGM2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%; Zebrafish: 86% |
Image 1 | Human THP-1
 | WB Suggested Anti-PGM2 Antibody Titration: 1.0 ug/ml Positive Control: THP-1 Whole Cell |
|
|