PGM2 Antibody - C-terminal region (ARP63674_P050)

• Name: PGM2 Antibody - C-terminal region (ARP63674_P050)
• Protein Size (# AA): 612 amino acids
• Molecular Weight: 67kDa
• NCBI Gene Id: 55276
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Phosphoglucomutase 2
• Alias Symbols: MSTP006
• Peptide Sequence: Synthetic peptide located within the following region: AIRDLTTGYDDSQPDKKAVLPTSKSSQMITFTFANGGVATMRTSGTEPKI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: PGM2 catalyzes the conversion of the nucleoside breakdown products ribose-1-phosphate and deoxyribose-1-phosphate to the corresponding 5-phosphopentoses. PGM2 may also catalyze the interconversion of glucose-1-phosphate and glucose-6-phosphate. PGM2 has low glucose 1,6-bisphosphate synthase activity.
• Protein Interactions: UBC; BAG3; PGM1; ACD; TINF2; POT1; TERF1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PGM2 (ARP63674_P050) antibody is Catalog # AAP63674
• Uniprot ID: Q96G03
• Protein Name: Phosphoglucomutase-2
• Protein Accession #: NP_060760
• Purification: Affinity Purified
• Nucleotide Accession #: NM_018290
• Tested Species Reactivity: Human
• Gene Symbol: PGM2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%; Zebrafish: 86%
• Image 1: Human THP-1
  
  WB Suggested Anti-PGM2 Antibody
  Titration: 1.0 ug/ml
  Positive Control: THP-1 Whole Cell