| Product Number |
ARP63658_P050 |
| Product Page |
www.avivasysbio.com/ncr1-antibody-c-terminal-region-arp63658-p050.html |
| Name |
NCR1 Antibody - C-terminal region (ARP63658_P050) |
| Protein Size (# AA) |
304 amino acids |
| Molecular Weight |
33kDa |
| NCBI Gene Id |
9437 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Natural cytotoxicity triggering receptor 1 |
| Alias Symbols |
LY94, CD335, NKP46, NK-p46 |
| Peptide Sequence |
Synthetic peptide located within the following region: WDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
NCR1 is a cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. |
| Protein Interactions |
PHF1; CD247; FCER1G; CD59; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NCR1 (ARP63658_P050) antibody |
| Blocking Peptide |
For anti-NCR1 (ARP63658_P050) antibody is Catalog # AAP63658 |
| Uniprot ID |
O76036 |
| Protein Name |
Natural cytotoxicity triggering receptor 1 |
| Sample Type Confirmation |
NCR1 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3 |
| Protein Accession # |
NP_004820 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_004829 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NCR1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human OVCAR3
 | WB Suggested Anti-NCR1 Antibody
Titration: 1.0 ug/ml
Positive Control: OVCAR-3 Whole CellNCR1 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells |
|
|
