SYNC Antibody - C-terminal region (ARP63616_P050)

Data Sheet
 
Product Number ARP63616_P050
Product Page www.avivasysbio.com/sync-antibody-c-terminal-region-arp63616-p050.html
Name SYNC Antibody - C-terminal region (ARP63616_P050)
Protein Size (# AA) 476 amino acids
Molecular Weight 52kDa
NCBI Gene Id 81493
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Syncoilin, intermediate filament protein
Alias Symbols SYNC1, SYNCOILIN
Peptide Sequence Synthetic peptide located within the following region: MKEALRPLQAEARQLRLQNRNLEDQIALVRQKRDEEVQQYREQLEEMEER
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a member of the intermediate filament family which contains an N-terminal head domain, followed by a central coiled-coil region and a short C-terminal tail. The protein is highly expressed in skeletal and cardiac muscle. The protein links the dystrophin associated protein complex (DAPC) to desmin filaments in muscle and may have a structural role in striated muscle. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein Interactions DTNA; DES;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SYNC (ARP63616_P050) antibody
Blocking Peptide For anti-SYNC (ARP63616_P050) antibody is Catalog # AAP63616
Uniprot ID Q9H7C4-2
Protein Name Syncoilin
Protein Accession # NP_001155180
Purification Affinity Purified
Nucleotide Accession # NM_001161708
Tested Species Reactivity Human
Gene Symbol SYNC
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human U937
WB Suggested Anti-SYNC Antibody
Titration: 1.0 ug/ml
Positive Control: U937 Whole Cell
Image 2
Human heart tissue
Rabbit Anti-SYNC Antibody
Catalog Number: ARP63616_P050
Formalin Fixed Paraffin Embedded Tissue: Human Heart Tissue
Observed Staining: Cytoplasm in perinuclear
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com