DRD1 Antibody - N-terminal region (ARP63609_P050)

Data Sheet
 
Product Number ARP63609_P050
Product Page www.avivasysbio.com/drd1-antibody-n-terminal-region-arp63609-p050.html
Name DRD1 Antibody - N-terminal region (ARP63609_P050)
Protein Size (# AA) 446 amino acids
Molecular Weight 49kDa
NCBI Gene Id 1812
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Dopamine receptor D1
Alias Symbols DADR, DRD1A
Peptide Sequence Synthetic peptide located within the following region: AAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLAETIDNCDS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes the D1 subtype of the dopamine receptor. The D1 subtype is the most abundant dopamine receptor in the central nervous system. This G-protein coupled receptor stimulates adenylyl cyclase and activates cyclic AMP-dependent protein kinases. D1 receptors regulate neuronal growth and development, mediate some behavioral responses, and modulate dopamine receptor D2-mediated events.
Protein Interactions RANBP10; RANBP9; HRH3; GRIN1; DNAJC14; COPG1; EPB41L2; CALY; COPG2; CAV2; FLNA; ADORA1; ADA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DRD1 (ARP63609_P050) antibody
Blocking Peptide For anti-DRD1 (ARP63609_P050) antibody is Catalog # AAP63609
Uniprot ID P21728
Protein Name D(1A) dopamine receptor
Protein Accession # NP_000785
Purification Affinity Purified
Nucleotide Accession # NM_000794
Tested Species Reactivity Human
Gene Symbol DRD1
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%
Image 1
Human 293T
WB Suggested Anti-DRD1 Antibody
Titration: 1.0 ug/ml
Positive Control: 293T Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com