CRHR1 Antibody - C-terminal region (ARP63607_P050)

Data Sheet
 
Product Number ARP63607_P050
Product Page www.avivasysbio.com/crhr1-antibody-c-terminal-region-arp63607-p050.html
Name CRHR1 Antibody - C-terminal region (ARP63607_P050)
Protein Size (# AA) 401 amino acids
Molecular Weight 44kDa
NCBI Gene Id 1394
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Corticotropin releasing hormone receptor 1
Description
Alias Symbols CRF1, CRHR, CRF-R, CRFR1, CRF-R1, CRFR-1, CRH-R1, CRHR1L, CRF-R-1, CRH-R-1
Peptide Sequence Synthetic peptide located within the following region: RPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a G-protein coupled receptor that binds neuropeptides of the corticotropin releasing hormone family that are major regulators of the hypothalamic-pituitary-adrenal pathway. The encoded protein is essential for the activation of signal transduction pathways that regulate diverse physiological processes including stress, reproduction, immune response and obesity. Alternative splicing results in multiple transcript variants one of which is a non-coding read-through transcript with the neighboring gene MGC57346.
Protein Interactions SRPK1; GNAI1; CALM1; UCN3; CRH; GNAQ; UCN; GNAS; GNAO1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CRHR1 (ARP63607_P050) antibody
Blocking Peptide For anti-CRHR1 (ARP63607_P050) antibody is Catalog # AAP63607
Uniprot ID P34998-4
Protein Name Corticotropin-releasing factor receptor 1
Publications

Proton Sensitivity of Corticotropin-Releasing Hormone Receptor 1 Signaling to Proopiomelanocortin in Male Mice. Endocrinology. 160, 276-291 (2019). 30535142

Protein Accession # NP_001138620
Purification Affinity Purified
Nucleotide Accession # NM_001145148
Tested Species Reactivity Human, Mouse
Gene Symbol CRHR1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Image 1
Human HeLa
WB Suggested Anti-CRHR1 Antibody
Titration: 1.0 ug/ml
Positive Control: Hela Whole Cell
Image 2
Mouse Testis
Host: Mouse
Target Name: CRHR1
Sample Tissue: Mouse Testis
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com