Product Number |
ARP63486_P050 |
Product Page |
www.avivasysbio.com/cnr2-antibody-c-terminal-region-arp63486-p050.html |
Name |
CNR2 Antibody - C-terminal region (ARP63486_P050) |
Protein Size (# AA) |
360 amino acids |
Molecular Weight |
40kDa |
NCBI Gene Id |
1269 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Cannabinoid receptor 2 (macrophage) |
Alias Symbols |
CB2, CX5, CB-2 |
Peptide Sequence |
Synthetic peptide located within the following region: MVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The cannabinoid delta-9-tetrahydrocannabinol is the principal psychoactive ingredient of marijuana. The proteins encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1) gene have the characteristics of a guanine nucleotide-binding protein (G-protein)-coupled receptor for cannabinoids. They inhibit adenylate cyclase activity in a dose-dependent, stereoselective, and pertussis toxin-sensitive manner. These proteins have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. The cannabinoid receptors are members of family 1 of the G-protein-coupled receptors. |
Protein Interactions |
GNA15; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CNR2 (ARP63486_P050) antibody |
Blocking Peptide |
For anti-CNR2 (ARP63486_P050) antibody is Catalog # AAP63486 |
Uniprot ID |
P34972 |
Protein Name |
Cannabinoid receptor 2 |
Publications |
Wilhelmsen, K. et al. The endocannabinoid/endovanilloid N-arachidonoyl dopamine (NADA) and synthetic cannabinoid WIN55,212-2 abate the inflammatory activation of human endothelial cells. J. Biol. Chem. 289, 13079-100 (2014). 24644287 |
Sample Type Confirmation |
CNR2 is supported by BioGPS gene expression data to be expressed in 721_B |
Protein Accession # |
NP_001832 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001841 |
Tested Species Reactivity |
Human |
Gene Symbol |
CNR2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Horse: 83%; Human: 100%; Mouse: 79%; Rat: 86% |
Image 1 | Human 721_B
| WB Suggested Anti-CNR2 Antibody Titration: 1.0 ug/ml Positive Control: 721_B Whole CellCNR2 is supported by BioGPS gene expression data to be expressed in 721_B |
|
|