CNR2 Antibody - C-terminal region (ARP63486_P050)

Data Sheet
 
Product Number ARP63486_P050
Product Page www.avivasysbio.com/cnr2-antibody-c-terminal-region-arp63486-p050.html
Name CNR2 Antibody - C-terminal region (ARP63486_P050)
Protein Size (# AA) 360 amino acids
Molecular Weight 40kDa
NCBI Gene Id 1269
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cannabinoid receptor 2 (macrophage)
Alias Symbols CB2, CX5, CB-2
Peptide Sequence Synthetic peptide located within the following region: MVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The cannabinoid delta-9-tetrahydrocannabinol is the principal psychoactive ingredient of marijuana. The proteins encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1) gene have the characteristics of a guanine nucleotide-binding protein (G-protein)-coupled receptor for cannabinoids. They inhibit adenylate cyclase activity in a dose-dependent, stereoselective, and pertussis toxin-sensitive manner. These proteins have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. The cannabinoid receptors are members of family 1 of the G-protein-coupled receptors.
Protein Interactions GNA15;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CNR2 (ARP63486_P050) antibody
Blocking Peptide For anti-CNR2 (ARP63486_P050) antibody is Catalog # AAP63486
Uniprot ID P34972
Protein Name Cannabinoid receptor 2
Publications

Wilhelmsen, K. et al. The endocannabinoid/endovanilloid N-arachidonoyl dopamine (NADA) and synthetic cannabinoid WIN55,212-2 abate the inflammatory activation of human endothelial cells. J. Biol. Chem. 289, 13079-100 (2014). 24644287

Sample Type Confirmation

CNR2 is supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_001832
Purification Affinity Purified
Nucleotide Accession # NM_001841
Tested Species Reactivity Human
Gene Symbol CNR2
Predicted Species Reactivity Human, Mouse, Rat, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Horse: 83%; Human: 100%; Mouse: 79%; Rat: 86%
Image 1
Human 721_B
WB Suggested Anti-CNR2 Antibody
Titration: 1.0 ug/ml
Positive Control: 721_B Whole CellCNR2 is supported by BioGPS gene expression data to be expressed in 721_B
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com