CD1E Antibody - C-terminal region (ARP63420_P050)

• Product Number: ARP63420_P050
• Name: CD1E Antibody - C-terminal region (ARP63420_P050)
• Protein Size (# AA): 290 amino acids
• Molecular Weight: 31kDa
• NCBI Gene Id: 913
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: CD1b molecule
• Alias Symbols: R2, CD1A
• Peptide Sequence: Synthetic peptide located within the following region: WVMWMRGEQEQRGTQRGDVLPNADETWWIFHLSHPDLFDCDSYPGHIGCS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes within Golgi compartments, endosomes, and lysosomes, and is cleaved into a stable soluble form. The soluble form is required for the intracellular processing of some glycolipids into a form that can be presented by other CD1 family members. Many alternatively spliced transcript variants encoding different isoforms have been described. Additional transcript variants have been found; however, their biological validity has not been determined.
• Protein Interactions: UBC; B2M;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CD1E (ARP63420_P050) antibody is Catalog # AAP63420
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CD1E
• Uniprot ID: P15812-3
• Protein Name: T-cell surface glycoprotein CD1e, membrane-associated
• Purification: Affinity Purified
• Tested Species Reactivity: Human
• Gene Symbol: CD1E
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 86%; Rat: 79%; Sheep: 79%
• Image 1: Human NCI-H226
  
  Host: Rabbit
  Target Name: CD1E
  Sample Type: NCI-H226 Whole Cell lysates
  Antibody Dilution: 1.0ug/ml