CCNB2 Antibody - C-terminal region (ARP63411_P050)

• Product Number: ARP63411_P050
• Name: CCNB2 Antibody - C-terminal region (ARP63411_P050)
• Protein Size (# AA): 398 amino acids
• Molecular Weight: 44kDa
• NCBI Gene Id: 9133
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cyclin B2
• Alias Symbols: HsT17299
• Peptide Sequence: Synthetic peptide located within the following region: VLEVMQHMAKNVVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyclin B1 co-localizes with microtubules, whereas cyclin B2 is primarily associated with the Golgi region. Cyclin B2 also binds to transforming growth factor beta RII and thus cyclin B2/cdc2 may play a key role in transforming growth factor beta-mediated cell cycle control.
• Protein Interactions: CKS2; CKS1B; CDK1; CDK2; MCM2; CDKN1A; ATR; UBC; tat; TSPYL2; TGFBR2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CCNB2 (ARP63411_P050) antibody is Catalog # AAP63411
• Uniprot ID: O95067
• Protein Name: G2/mitotic-specific cyclin-B2
• Sample Type Confirmation:

  CCNB2 is supported by BioGPS gene expression data to be expressed in HCT116, NCIH226

• Protein Accession #: NP_004692
• Purification: Affinity Purified
• Nucleotide Accession #: NM_004701
• Tested Species Reactivity: Human
• Gene Symbol: CCNB2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 86%
• Image 1: Human NCI-H226
  
  WB Suggested Anti-CCNB2 Antibody
  Titration: 1.0 ug/ml
  Positive Control: NCI-H226 Whole CellCCNB2 is supported by BioGPS gene expression data to be expressed in NCIH226
• Image 2: Human HCT116
  
  Lanes:
  Lane1: 40 ug human HCT116 cell lysate
  Lane2: 40 ug 1mM hydroxyurea treated HCT116 cell lysate
  Lane3: 40 ug 10uM Etoposide treated human HCT116 cell lysate
  Primary Antibody Dilution:
  1:1000
  Secondary Antibody:
  Anti-rabbit HRP
  Secondary Antibody Dilution:
  1:5000
  Gene Name:
  CCNB2
  Submitted by:
  Claudia Schafer & Dr. Oliver Kramer, Institute for Biochemistry and Biophysics, Center for Molecular Biomedicine, Friedrich-Schiller University Jena
  CCNB2 is supported by BioGPS gene expression data to be expressed in HCT116