RGR Antibody - N-terminal region (ARP63387_P050)

Data Sheet
 
Product Number ARP63387_P050
Product Page www.avivasysbio.com/rgr-antibody-n-terminal-region-arp63387-p050.html
Name RGR Antibody - N-terminal region (ARP63387_P050)
Protein Size (# AA) 295 amino acids
Molecular Weight 32kDa
NCBI Gene Id 5995
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Retinal G protein coupled receptor
Alias Symbols RP44
Peptide Sequence Synthetic peptide located within the following region: SLLRVSHRRWPYGSDGCQAHGFQGFVTALASICSSAAIAWGRYHHYCTRS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a putative retinal G-protein coupled receptor. The gene is a member of the opsin subfamily of the 7 transmembrane, G-protein coupled receptor 1 family. Like other opsins which bind retinaldehyde, it contains a conserved lysine residue in the seventh transmembrane domain. The protein acts as a photoisomerase to catalyze the conversion of all-trans-retinal to 11-cis-retinal. The reverse isomerization occurs with rhodopsin in retinal photoreceptor cells. The protein is exclusively expressed in tissue adjacent to retinal photoreceptor cells, the retinal pigment epithelium and Mueller cells. This gene may be associated with autosomal recessive and autosomal dominant retinitis pigmentosa (arRP and adRP, respectively).
Protein Interactions KIAA1279; RDH5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RGR (ARP63387_P050) antibody
Blocking Peptide For anti-RGR (ARP63387_P050) antibody is Catalog # AAP63387
Uniprot ID P47804-2
Protein Name RPE-retinal G protein-coupled receptor
Sample Type Confirmation

RGR is supported by BioGPS gene expression data to be expressed in PANC1

Protein Accession # NP_002912
Purification Affinity Purified
Nucleotide Accession # NM_002921
Tested Species Reactivity Human
Gene Symbol RGR
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 100%; Rat: 86%; Zebrafish: 93%
Image 1
Human PANC1
WB Suggested Anti-RGR Antibody
Titration: 1.0 ug/ml
Positive Control: PANC1 Whole CellRGR is supported by BioGPS gene expression data to be expressed in PANC1
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com