ADIPOR1 Antibody - C-terminal region (ARP63341_P050)

• Name: ADIPOR1 Antibody - C-terminal region (ARP63341_P050)
• Protein Size (# AA): 375 amino acids
• Molecular Weight: 41 kDa
• NCBI Gene Id: 51094
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Adiponectin receptor 1
• Alias Symbols: CGI45, PAQR1, ACDCR1, CGI-45, TESBP1A
• Peptide Sequence: Synthetic peptide located within the following region: FPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The adiponectin receptors, ADIPOR1 and ADIPOR2, serve as receptors for globular and full-length adiponectin and mediate increased AMPK and PPAR-alpha ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin.
• Protein Interactions: APPL1; DPH3; NAA20; UBC; NFKBIL1; MYC; APLP2; ELAVL1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-ADIPOR1 (ARP63341_P050) antibody is Catalog # AAP63341
• Uniprot ID: Q96A54
• Protein Name: Adiponectin receptor protein 1
• Sample Type Confirmation:

  ADIPOR1 is supported by BioGPS gene expression data to be expressed in MDA-MB435

• Protein Accession #: NP_057083
• Purification: Affinity Purified
• Nucleotide Accession #: NM_015999
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: ADIPOR1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Zebrafish
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Mouse Testis
  
  Host: Mouse
  Target Name: ADIPOR1
  Sample Tissue: Mouse Testis
  Antibody Dilution: 1ug/ml
• Image 2: Human thyroid tissue
  
  Rabbit Anti-ADIPOR1 Antibody
  Catalog Number: ARP63341_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Thyroid Tissue
  Observed Staining: Plasma membrane and cytoplasm in follicular cells
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1:600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
• Image 3: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.