DPP4 Antibody - C-terminal region (ARP63319_P050)

• Product Number: ARP63319_P050
• Name: DPP4 Antibody - C-terminal region (ARP63319_P050)
• Protein Size (# AA): 766 amino acids
• Molecular Weight: 84kDa
• NCBI Gene Id: 1803
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Dipeptidyl-peptidase 4
• Description:
  View product citations for DPP4 Antibody - C-terminal region (ARP63319_P050) on CiteAb
• Alias Symbols: CD26, ADABP, ADCP2, DPPIV, TP103
• Peptide Sequence: Synthetic peptide located within the following region: DSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The protein encoded by this gene is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides.
• Protein Interactions: DKK1; CARD11; BCL10; IKBKB; CPAMD8; GRP; CXCL11; CCL22; CXCL9; CCL3L1; CCL11; CXCL12; FAP; DPP4; CCL5; CD4; CXCR4; PTPRC; CXCL10; ADA;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-DPP4 (ARP63319_P050) antibody is Catalog # AAP63319
• Uniprot ID: P27487
• Protein Name: Dipeptidyl peptidase 4
• Publications:

  Upregulated expression and activation of membrane‑associated proteases in esophageal squamous cell carcinoma. Oncol Rep. 31, 2820-6 (2014). 24789592

• Protein Accession #: NP_001926
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001935
• Tested Species Reactivity: Human
• Gene Symbol: DPP4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
• Image 1: Human 721_B
  
  WB Suggested Anti-DPP4 Antibody
  Titration: 1.0 ug/ml
  Positive Control: 721_B Whole Cell
• Image 2: Human
  
  Lanes:
  Lane 1: 15ug MDA-MB-231 lysate
  Lane 2: 15ug MCF-7 lysate
  Primary Antibody Dilution:
  1:1000
  Secondary Antibody:
  Donkey anti-rabbit-HRP
  Secondary Antibody Dilution:
  1:10000
  Gene Name:
  DPP4
  Submitted by:
  Katarzyna Augoff, University of Wroclaw
  
• Image 3: Normal Human Prostate
  
  Product Page for DPP4 antibody - C-terminal region (ARP63319_P050)
  
  
  
  Sample Type:
  Normal Human Prostate
  Primary Antibody Dilution:
  1ug/mL
  Color/Signal Descriptions:
  DPP4 (DAB; brown), nuclei (hematoxylin; blue)
  Gene Name:
  DPP4
  
• Image 4: Normal Human Prostate
  
  Product Page for DPP4 antibody - C-terminal region (ARP63319_P050)
  
  
  
  Sample Type:
  Normal Human Prostate
  Primary Antibody Dilution:
  1ug/mL
  Color/Signal Descriptions:
  DPP4 (DAB; brown), nuclei (hematoxylin; blue)
  Gene Name:
  DPP4