KLRK1 Antibody - C-terminal region : Biotin (ARP63273_P050-Biotin)

Data Sheet
 
Product Number ARP63273_P050-Biotin
Product Page www.avivasysbio.com/klrk1-antibody-c-terminal-region-biotin-arp63273-p050-biotin.html
Name KLRK1 Antibody - C-terminal region : Biotin (ARP63273_P050-Biotin)
Protein Size (# AA) 216 amino acids
Molecular Weight 24kDa
Conjugation Biotin
NCBI Gene Id 22914
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Killer cell lectin-like receptor subfamily K, member 1
Alias Symbols KLR, CD314, NKG2D, NKG2-D, D12S2489E
Peptide Sequence Synthetic peptide located within the following region: YESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWED
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. This gene encodes a member of the NKG2 family. The encoded transmembrane protein is characterized by a type II membrane orientation (has an extracellular C terminus) and the presence of a C-type lectin domain. It binds to a diverse family of ligands that include MHC class I chain-related A and B proteins and UL-16 binding proteins, where ligand-receptor interactions can result in the activation of NK and T cells. The surface expression of these ligands is important for the recognition of stressed cells by the immune system, and thus this protein and its ligands are therapeutic targets for the treatment of immune diseases and cancers. Read-through transcription exists between this gene and the upstream KLRC4 (killer cell lectin-like receptor subfamily C, member 4) family member in the same cluster.
Protein Interactions KLRK1; RAET1G; RAET1E; ULBP3; HLA-B; TYROBP; HCST; MICB; RAE1;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-KLRK1 (ARP63273_P050-Biotin) antibody
Blocking Peptide For anti-KLRK1 (ARP63273_P050-Biotin) antibody is Catalog # AAP63273
Uniprot ID P26718
Protein Name NKG2-D type II integral membrane protein
Protein Accession # NP_031386
Purification Affinity Purified
Nucleotide Accession # NM_007360
Gene Symbol KLRK1
Predicted Species Reactivity Human, Mouse, Rat, Cow
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Human: 100%; Mouse: 79%; Rat: 79%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com