DRD3 Antibody - C-terminal region (ARP63162_P050)

Data Sheet
 
Product Number ARP63162_P050
Product Page www.avivasysbio.com/drd3-antibody-c-terminal-region-arp63162-p050.html
Name DRD3 Antibody - C-terminal region (ARP63162_P050)
Protein Size (# AA) 367 amino acids
Molecular Weight 41kDa
NCBI Gene Id 1814
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Dopamine receptor D3
Alias Symbols D3DR, ETM1, FET1
Peptide Sequence Synthetic peptide located within the following region: QERGGELKREEKTRNSLMPLREKKATQMVAIVLGAFIVCWLPFFLTHVLN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes the D3 subtype of the five (D1-D5) dopamine receptors. The activity of the D3 subtype receptor is mediated by G proteins which inhibit adenylyl cyclase. This receptor is localized to the limbic areas of the brain, which are associated with cognitive, emotional, and endocrine functions. Genetic variation in this gene may be associated with susceptibility to hereditary essential tremor 1. Alternative splicing of this gene results in transcript variants encoding different isoforms, although some variants may be subject to nonsense-mediated decay (NMD).
Protein Interactions SLC9A3; USP48; EEF1G; CLIC6; MPDZ; EPB41L2; GIPC1; NCS1; EPB41L1; EEF1B2; NCK1; FLNA; GNAI1; EPB41; GRB2; RDX;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DRD3 (ARP63162_P050) antibody
Blocking Peptide For anti-DRD3 (ARP63162_P050) antibody is Catalog # AAP63162
Uniprot ID P35462
Protein Name D(3) dopamine receptor
Protein Accession # NP_387512
Purification Affinity Purified
Nucleotide Accession # NM_033663
Tested Species Reactivity Human
Gene Symbol DRD3
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 77%; Dog: 86%; Guinea Pig: 75%; Horse: 79%; Human: 100%; Pig: 79%; Rat: 86%
Image 1
Human HepG2
WB Suggested Anti-DRD3 Antibody
Titration: 1.0 ug/ml
Positive Control: HepG2 Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com